DKFZp686P1551 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DKFZp686P1551

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein DKFZp686P1551 EMBL CAH56185.1

Protein Size: 573

Purification: Affinity Purified

• SKU: AVIARP54434_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54434_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23265
• Host: Rabbit
• Conjugate: Conjugated, FITC