DKK1 Antibody - C-terminal region : Biotin

DKK1 Antibody - C-terminal region : Biotin
SKU
AVIARP55048_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DKK1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dickkopf-related protein 1

Protein Size: 266

Purification: Affinity Purified
More Information
SKU AVIARP55048_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55048_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22943
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×