DKKL1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DKKL1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dickkopf-like protein 1

Protein Size: 242

Purification: Affinity Purified

• SKU: AVIARP53695_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53695_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27120
• Host: Rabbit
• Conjugate: Conjugated, HRP