DNAJB1 Antibody - N-terminal region : Biotin

DNAJB1 Antibody - N-terminal region : Biotin
SKU
AVIARP54795_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1

Key Reference: Cheng,X., (2008) J. Virol. 82 (3), 1229-1237

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily B member 1

Protein Size: 340

Purification: Affinity Purified
More Information
SKU AVIARP54795_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54795_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3337
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×