DNALI1 Antibody - N-terminal region : FITC

DNALI1 Antibody - N-terminal region : FITC
SKU
AVIARP53611_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNALI1

Key Reference: Combs,J., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (40), 14883-14888

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Axonemal dynein light intermediate polypeptide 1

Protein Size: 280

Purification: Affinity Purified
More Information
SKU AVIARP53611_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53611_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7802
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×