DOG-1(DOG1.1), CF740 conjugate, 0.1mg/mL

DOG-1(DOG1.1), CF740 conjugate, 0.1mg/mL
SKU
BTMBNC740725-500
Packaging Unit
500 uL
Manufacturer
Biotium

Availability: loading...
Price is loading...
Description: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Product origin: Animal - Mus musculus (mouse), Bos taurus (bovine)

Conjugate: CF740

Concentration: 0.1 mg/mL

Storage buffer: PBS, 0.1% rBSA, 0.05% azide

Clone: DOG1.1

Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.

Antibody Reactivity: DOG-1/TMEM16A

Entrez Gene ID: 55107

Z-Antibody Applications: IHC, FFPE (verified)

Verified AB Applications: IHC (FFPE) (verified)

Antibody Application Notes: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody/Immunofluorescence: 0.5-1 ug/mL/Immunohistology formalin-fixed 0.25-0.5 ug/mL/Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes/Flow Cytometry 0.5-1 ug/million cells/0.1 mL/Optimal dilution for a specific application should be determined by user
More Information
SKU BTMBNC740725-500
Manufacturer Biotium
Manufacturer SKU BNC740725-500
Package Unit 500 uL
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Immunohistochemistry
Isotype IgG1 kappa
Host Mouse
Conjugate Conjugated, CF740
Product information (PDF) Download
MSDS (PDF) Download