Description: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Product origin: Animal - Mus musculus (mouse), Bos taurus (bovine)
Conjugate: CF740
Concentration: 0.1 mg/mL
Storage buffer: PBS, 0.1% rBSA, 0.05% azide
Clone: DOG1.1
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Antibody Reactivity: DOG-1/TMEM16A
Entrez Gene ID: 55107
Z-Antibody Applications: IHC, FFPE (verified)
Verified AB Applications: IHC (FFPE) (verified)
Antibody Application Notes: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody/Immunofluorescence: 0.5-1 ug/mL/Immunohistology formalin-fixed 0.25-0.5 ug/mL/Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes/Flow Cytometry 0.5-1 ug/million cells/0.1 mL/Optimal dilution for a specific application should be determined by user