DOK6 Antibody - middle region : FITC

DOK6 Antibody - middle region : FITC
SKU
AVIARP55502_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DOK6 is a member of the DOK (see DOK1; MIM 602919) family of intracellular adaptors that play a role in the RET (MIM 164761) signaling cascade (Crowder et al., 2004 [PubMed 15286081]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DOK6

Molecular Weight: 38

Peptide Sequence: Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Docking protein 6

Protein Size: 331

Purification: Affinity Purified
More Information
SKU AVIARP55502_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55502_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220164
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×