DPY19L2 Antibody - middle region : FITC

DPY19L2 Antibody - middle region : FITC
SKU
AVIARP55709_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact functions of DPY19L2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2

Key Reference: Carson,A.R., (er) BMC Genomics 7, 45 (2006)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein dpy-19 homolog 2

Protein Size: 758

Purification: Affinity Purified
More Information
SKU AVIARP55709_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55709_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283417
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×