DUS1L Antibody - middle region : Biotin

DUS1L Antibody - middle region : Biotin
SKU
AVIARP57616_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUS1L

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like

Protein Size: 473

Purification: Affinity Purified
More Information
SKU AVIARP57616_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57616_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64118
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×