EEA1 Antibody - middle region : HRP

EEA1 Antibody - middle region : HRP
SKU
AVIARP58125_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EEA1

Key Reference: Selak,S., (2006) Neuroscience 143 (4), 953-964

Molecular Weight: 162kDa

Peptide Sequence: Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Early endosome antigen 1

Protein Size: 1411

Purification: Affinity Purified
More Information
SKU AVIARP58125_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58125_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 8411
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×