EEA1 Antibody - N-terminal region : Biotin

EEA1 Antibody - N-terminal region : Biotin
SKU
AVIARP58126_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EEA1

Molecular Weight: 162kDa

Peptide Sequence: Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early endosome antigen 1

Protein Size: 1411

Purification: Affinity Purified
More Information
SKU AVIARP58126_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58126_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8411
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×