EFHC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human EFHC1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing protein 1

Protein Size: 550

Purification: Affinity Purified

• SKU: AVIARP53729_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53729_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 114327
• Host: Rabbit
• Conjugate: Conjugated, Biotin