EGFLAM Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: EGFLAM is involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. It is necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse and promotes matrix assembly and cell adhesiveness.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EGFLAM

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pikachurin

Protein Size: 375

Purification: Affinity Purified

• SKU: AVIARP53435_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53435_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 133584
• Host: Rabbit
• Conjugate: Conjugated, Biotin