EHD4 Antibody - middle region : Biotin

EHD4 Antibody - middle region : Biotin
SKU
AVIARP55432_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EH domain-containing protein 4

Protein Size: 541

Purification: Affinity Purified
More Information
SKU AVIARP55432_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55432_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30844
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×