ELMOD1 Antibody - N-terminal region : FITC

ELMOD1 Antibody - N-terminal region : FITC
SKU
AVIARP57288_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ELMOD1 acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELMOD1

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ELMO domain-containing protein 1

Protein Size: 190

Purification: Affinity Purified
More Information
SKU AVIARP57288_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57288_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55531
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×