ELP4 Antibody - C-terminal region : Biotin

ELP4 Antibody - C-terminal region : Biotin
SKU
AVIARP55367_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELP4

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongator complex protein 4

Protein Size: 535

Purification: Affinity Purified
More Information
SKU AVIARP55367_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55367_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26610
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×