EML3 Antibody - N-terminal region : Biotin

EML3 Antibody - N-terminal region : Biotin
SKU
AVIARP55579_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EML3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Echinoderm microtubule-associated protein-like 3

Protein Size: 896

Purification: Affinity Purified
More Information
SKU AVIARP55579_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55579_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256364
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×