ENOSF1 Antibody - middle region : Biotin

ENOSF1 Antibody - middle region : Biotin
SKU
AVIARP56964_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to the 3'UTR and terminal intron of the thymidylate synthase (TS) RNA and down-regulates TS expression. Other transcript variants (rTSbeta and rTSgamma) do not overlap the TS locus. The function of this gene appears to be primarily to regulate expression of the TS locus both via the antisense transcript as well as through the encoded proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ENOSF1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mitochondrial enolase superfamily member 1

Protein Size: 367

Purification: Affinity Purified
More Information
SKU AVIARP56964_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56964_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55556
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×