ENOSF1 Antibody - N-terminal region : Biotin

ENOSF1 Antibody - N-terminal region : Biotin
SKU
AVIARP56963_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1

Key Reference: Giusti,B., (er) Biochem. Genet. (2008) In press

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial enolase superfamily member 1

Protein Size: 443

Purification: Affinity Purified
More Information
SKU AVIARP56963_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56963_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55556
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×