EP4 Receptor (C-Term) Blocking Peptide

Shelf life (days): 1095.0

Formulation: A lyophilized peptide

Formula Weight: 0.0

Notes: Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

• SKU: CAY301775-1
• Manufacturer: Cayman Chemical
• Manufacturer SKU: 301775-1
• Package Unit: 1 Piece
• Quantity Unit: STK
• Application: Immunofluorescence, Western Blotting, Immunohistochemistry
• Conjugate: Unconjugated