EPC2 Antibody - C-terminal region : HRP

EPC2 Antibody - C-terminal region : HRP
SKU
AVIARP55311_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EPC2 may play a role in transcription or DNA repair.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPC2

Key Reference: N/A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Enhancer of polycomb homolog 2

Protein Size: 807

Purification: Affinity purified
More Information
SKU AVIARP55311_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55311_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26122
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×