EPN1 Antibody - C-terminal region : FITC

EPN1 Antibody - C-terminal region : FITC
SKU
AVIARP54940_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPN1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epsin-1

Protein Size: 662

Purification: Affinity Purified
More Information
SKU AVIARP54940_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54940_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29924
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×