EPS8 Antibody - middle region : Biotin

EPS8 Antibody - middle region : Biotin
SKU
AVIARP54726_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPS8

Key Reference: Welsch,T., (2007) Cancer Lett. 255 (2), 205-218

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epidermal growth factor receptor kinase substrate 8

Protein Size: 822

Purification: Affinity Purified
More Information
SKU AVIARP54726_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54726_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2059
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×