ERCC6L2 Antibody - C-terminal region : HRP

ERCC6L2 Antibody - C-terminal region : HRP
SKU
AVIARP54402_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Snf2 family of helicase-like proteins. The encoded protein may play a role in DNA repair and mitochondrial function. Mutations in this gene have been associated with bone marrow failure syndrome 2. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ERCC6L2

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: RDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA excision repair protein ERCC-6-like 2

Protein Size: 365

Purification: Affinity Purified
More Information
SKU AVIARP54402_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54402_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 375748
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×