ERVFRD-1 Antibody - C-terminal region : Biotin

ERVFRD-1 Antibody - C-terminal region : Biotin
SKU
AVIARP56009_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of a human endogenous retrovirus provirus on chromosome 6 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The gene's protein product plays a major role in placental development and trophoblast fusion. The protein has the characteristics of a typical retroviral envelope protein, including a cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERVFRD-1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HERV-FRD_6p24.1 provirus ancestral Env polyprotein

Protein Size: 538

Purification: Affinity Purified
More Information
SKU AVIARP56009_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56009_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 405754
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×