EYA3 Antibody - middle region : HRP

EYA3 Antibody - middle region : HRP
SKU
AVIARP57974_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EYA3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eyes absent homolog 3

Protein Size: 447

Purification: Affinity Purified
More Information
SKU AVIARP57974_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57974_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2140
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×