FAIM Antibody - middle region : FITC

FAIM Antibody - middle region : FITC
SKU
AVIARP56238_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAIM

Key Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fas apoptotic inhibitory molecule 1

Protein Size: 213

Purification: Affinity Purified
More Information
SKU AVIARP56238_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56238_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55179
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×