FAM13C1 Antibody - N-terminal region : Biotin

FAM13C1 Antibody - N-terminal region : Biotin
SKU
AVIARP54376_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM13C

Protein Size: 487

Purification: Affinity Purified
More Information
SKU AVIARP54376_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54376_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220965
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×