FAM29A Antibody - middle region : Biotin

FAM29A Antibody - middle region : Biotin
SKU
AVIARP56989_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HAUS6 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM29A

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: DFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HAUS augmin-like complex subunit 6

Protein Size: 955

Purification: Affinity Purified

Subunit: 6
More Information
SKU AVIARP56989_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56989_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54801
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×