FAM29A Antibody - middle region : FITC

FAM29A Antibody - middle region : FITC
SKU
AVIARP56990_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM29A

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HAUS augmin-like complex subunit 6

Protein Size: 955

Purification: Affinity Purified

Subunit: 6
More Information
SKU AVIARP56990_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56990_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54801
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×