FAM47A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA47A

Key Reference: N/A

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: RQLLKLDSERKLEDARAPCEGREKTTDEPTEPGKYPCGKFCPRPFETPLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein FAM47A

Protein Size: 791

Purification: Affinity purified

• SKU: AVIARP53496_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53496_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 158724
• Host: Rabbit
• Conjugate: Conjugated, Biotin