FAM50B Antibody - N-terminal region : Biotin

FAM50B Antibody - N-terminal region : Biotin
SKU
AVIARP54849_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of FAM50B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Key Reference: Sedlacek,Z., (1999) Genomics 61 (2), 125-132

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM50B

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP54849_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54849_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26240
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×