FAM50B Antibody - N-terminal region : Biotin

FAM50B Antibody - N-terminal region : Biotin
SKU
AVIARP54850_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of FAM50B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Key Reference: Sedlacek,Z., (1999) Genomics 61 (2), 125-132

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM50B

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP54850_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54850_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26240
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×