FAM50B Antibody - N-terminal region : HRP

FAM50B Antibody - N-terminal region : HRP
SKU
AVIARP54849_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of FAM50B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Key Reference: Sedlacek,Z., (1999) Genomics 61 (2), 125-132

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM50B

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP54849_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54849_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26240
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×