FAM79B Antibody - N-terminal region : FITC

FAM79B Antibody - N-terminal region : FITC
SKU
AVIARP55877_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM79B

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein p63-regulated gene 1 protein

Protein Size: 275

Purification: Affinity Purified
More Information
SKU AVIARP55877_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55877_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285386
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×