FAM80A Antibody - middle region : FITC

FAM80A Antibody - middle region : FITC
SKU
AVIARP55677_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FAM80A is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM80A

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acetylaspartyl-glutamate synthetase A

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP55677_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55677_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284716
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×