FAM98B Antibody - N-terminal region : HRP

FAM98B Antibody - N-terminal region : HRP
SKU
AVIARP55664_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FAM98B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM98B

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM98B Ensembl ENSP00000380734

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP55664_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55664_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283742
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×