FASTKD2 Antibody - middle region : Biotin

FASTKD2 Antibody - middle region : Biotin
SKU
AVIARP55108_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FAST kinase domain-containing protein 2

Protein Size: 710

Purification: Affinity Purified
More Information
SKU AVIARP55108_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55108_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22868
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×