FASTKD2 Antibody - middle region : HRP

FASTKD2 Antibody - middle region : HRP
SKU
AVIARP55108_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: FAST kinase domain-containing protein 2

Protein Size: 710

Purification: Affinity Purified
More Information
SKU AVIARP55108_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55108_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22868
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×