FBXO33 Antibody - middle region : FITC

FBXO33 Antibody - middle region : FITC
SKU
AVIARP55943_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognizes and binds to phosphorylated target proteins. Recognizes YBX1.Members of the F-box protein family, such as FBXO33, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO33

Key Reference: Jin,J., (2004) Genes Dev. 18 (21), 2573-2580

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box only protein 33

Protein Size: 555

Purification: Affinity Purified
More Information
SKU AVIARP55943_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55943_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 254170
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×