Fbxw4 Antibody - C-terminal region : Biotin

Fbxw4 Antibody - C-terminal region : Biotin
SKU
AVIARP57578_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of Fbxw4 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box and WD-40 domain protein 4 (Predicted) EMBL EDL94311.1

Protein Size: 408

Purification: Affinity Purified
More Information
SKU AVIARP57578_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57578_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 309444
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×