FGF14 Antibody - middle region : Biotin

FGF14 Antibody - middle region : Biotin
SKU
AVIARP54710_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGF14

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 14

Protein Size: 247

Purification: Affinity Purified
More Information
SKU AVIARP54710_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54710_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2259
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×