FITM1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 BX347190.2 448-541 c 95-825 BI114004.1 1-731 826-928 BQ574746.1 1-103 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FITM1

Key Reference: Kadereit,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 94-99

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fat storage-inducing transmembrane protein 1

Protein Size: 292

Purification: Affinity Purified

• SKU: AVIARP53492_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53492_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 161247
• Host: Rabbit
• Conjugate: Conjugated, FITC