FKBPL Antibody - N-terminal region : FITC

FKBPL Antibody - N-terminal region : FITC
SKU
AVIARP57597_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FKBPL

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FK506-binding protein-like

Protein Size: 349

Purification: Affinity Purified
More Information
SKU AVIARP57597_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57597_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63943
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×