FLII Antibody - middle region : FITC

FLII Antibody - middle region : FITC
SKU
AVIARP54614_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLII

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 145kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein flightless-1 homolog

Protein Size: 1269

Purification: Affinity Purified
More Information
SKU AVIARP54614_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54614_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2314
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×