FLJ25791 Antibody - middle region : Biotin

FLJ25791 Antibody - middle region : Biotin
SKU
AVIARP55644_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ25791

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 310

Purification: Affinity Purified
More Information
SKU AVIARP55644_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55644_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222521
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×