FLJ36070 Antibody - N-terminal region : Biotin

FLJ36070 Antibody - N-terminal region : Biotin
SKU
AVIARP55828_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FLJ36070 is a transcriptional coactivator.FLJ36070 stimulates the transcriptional activity of MEF2C. FLJ36070 stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MEF2-activating motif and SAP domain-containing transcriptional regulator

Protein Size: 312

Purification: Affinity Purified
More Information
SKU AVIARP55828_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55828_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284358
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×