FNDC11 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C20orf195

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: FDRKASAAHQDWARLRWFVTIQPATSEQYELRFRLLDPRTQQECAQCGVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: fibronectin type III domain-containing protein 11

Protein Size: 318

Purification: Affinity Purified

• SKU: AVIARP53764_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53764_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79025
• Host: Rabbit
• Conjugate: Conjugated, FITC