FNDC11 Antibody - N-terminal region : HRP

FNDC11 Antibody - N-terminal region : HRP
SKU
AVIARP53763_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf195

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: fibronectin type III domain-containing protein 11

Protein Size: 318

Purification: Affinity Purified
More Information
SKU AVIARP53763_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53763_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79025
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×