FNDC8 Antibody - N-terminal region : HRP

FNDC8 Antibody - N-terminal region : HRP
SKU
AVIARP56975_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of FNDC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC8

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fibronectin type III domain-containing protein 8

Protein Size: 324

Purification: Affinity Purified
More Information
SKU AVIARP56975_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56975_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54752
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×